PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI02G25650.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 339aa    MW: 38085.3 Da    PI: 4.7289
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI02G25650.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.14.8e-1967114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT++Ed+llv++v q+G g+W+++a+  g++R++k+c++rw +yl
  ORUFI02G25650.1  67 KGPWTAQEDKLLVEYVMQHGEGRWNSVAKITGLKRSGKSCRLRWVNYL 114
                      79********************************************97 PP

2Myb_DNA-binding50.64.5e-16120164147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  ORUFI02G25650.1 120 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 164
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.362114IPR017930Myb domain
SuperFamilySSF466893.12E-3065161IPR009057Homeodomain-like
SMARTSM007171.7E-1666116IPR001005SANT/Myb domain
PfamPF002495.8E-1867114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2468121IPR009057Homeodomain-like
CDDcd001673.43E-1269114No hitNo description
PROSITE profilePS5129424.933115169IPR017930Myb domain
SMARTSM007174.5E-15119167IPR001005SANT/Myb domain
PfamPF002498.0E-14120164IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-23122167IPR009057Homeodomain-like
CDDcd001675.48E-10124165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MAWAVVMSDD PENERGDSHH CERRQLRREE AKEERERDQE IDEEICLCKS MEGQQFAWGR  60
EEGGWRKGPW TAQEDKLLVE YVMQHGEGRW NSVAKITGLK RSGKSCRLRW VNYLRPDLKR  120
GKITPQEESV ILELHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP SKNIERARAR  180
FLKQRREMQQ QSQLMQTGQQ QQLGQDDDAT SAVVDDNLAE VAPPAATSLT HDGELQIMQE  240
MAPDMDDLLY YHPGDMSPYS YDDLLGSGGG ECGAVAASAG AAASTSEGSS EELDGGAATW  300
GSLWNLDDVV HDMMIDCAAG AGCCWGSFPP LQDQGLAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-25671677106B-MYB
1h8a_C7e-256716727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118070.0AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624171.10.0PREDICTED: transcription factor MYB57
TrEMBLA0A0E0NHV20.0A0A0E0NHV2_ORYRU; Uncharacterized protein
STRINGBGIOSGA006030-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.18e-66myb domain protein 305